Lineage for d2j23a1 (2j23 A:-4-106)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487871Species Malassezia sympodialis [TaxId:76777] [187890] (1 PDB entry)
  8. 2487872Domain d2j23a1: 2j23 A:-4-106 [165810]
    Other proteins in same PDB: d2j23a2, d2j23b2
    automated match to d1syra_

Details for d2j23a1

PDB Entry: 2j23 (more details), 1.41 Å

PDB Description: cross-reactivity and crystal structure of malassezia sympodialis thioredoxin (mala s 13), a member of a new pan-allergen family
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2j23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j23a1 c.47.1.0 (A:-4-106) automated matches {Malassezia sympodialis [TaxId: 76777]}
lvprgsvqvissydqfkqvtggdkvvvidfwatwcgpckmigpvfekisdtpagdkvgfy
kvdvdeqsqiaqevgiramptfvffkngqkidtvvgadpsklqaaitqhsa

SCOPe Domain Coordinates for d2j23a1:

Click to download the PDB-style file with coordinates for d2j23a1.
(The format of our PDB-style files is described here.)

Timeline for d2j23a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j23a2