Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (188 species) not a true protein |
Species Malassezia sympodialis [TaxId:76777] [187890] (1 PDB entry) |
Domain d2j23a1: 2j23 A:-4-106 [165810] Other proteins in same PDB: d2j23a2, d2j23b2 automated match to d1syra_ |
PDB Entry: 2j23 (more details), 1.41 Å
SCOPe Domain Sequences for d2j23a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j23a1 c.47.1.0 (A:-4-106) automated matches {Malassezia sympodialis [TaxId: 76777]} lvprgsvqvissydqfkqvtggdkvvvidfwatwcgpckmigpvfekisdtpagdkvgfy kvdvdeqsqiaqevgiramptfvffkngqkidtvvgadpsklqaaitqhsa
Timeline for d2j23a1: