Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
Protein automated matches [190725] (2 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [187884] (2 PDB entries) |
Domain d2iyga_: 2iyg A: [165771] automated match to d2buna1 complexed with dtt, dtu, fmn |
PDB Entry: 2iyg (more details), 2.3 Å
SCOPe Domain Sequences for d2iyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iyga_ d.58.10.2 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} gsdlvscsyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqwlegrpaav aevmthiqrdrrhsnveilaeepiakrrfagwhmqlscseadmrslgla
Timeline for d2iyga_: