SCOP 1.63: Domain d1hmob_: 1hmo B:

Lineage for d1hmob_ (1hmo B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin [47188] (1 family)

5. Family a.24.4.1: Hemerythrin [47189] (2 proteins)
   Iron-binding proteins

6. Protein Hemerythrin [47190] (2 species)

7. Species Sipunculid worm (Themiste dyscrita) [47191] (4 PDB entries)

8. Domain d1hmob_: 1hmo B: [16577]

Details for d1hmob_

PDB Entry: 1hmo, 2 Å

PDB Description: the structure of deoxy and oxy hemerythrin at 2.0 angstroms resolution

SCOP Domain Sequences for d1hmob_:

Sequence; same for both SEQRES and ATOM records:

>d1hmob_ a.24.4.1 (B:) Hemerythrin {Sipunculid worm (Themiste dyscrita)}
gfpipdpycwdisfrtfytiiddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqssqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki

Timeline for d1hmob_:

• d1hmob_ first appeared (with stable ids) in SCOP 1.55
  
• d1hmob_ appears in SCOP 1.61
  
• d1hmob_ appears in SCOP 1.65
  
• d1hmob_ appears in the current release, SCOPe 2.08