SCOP 1.63: Domain d2hmqb_: 2hmq B:

Lineage for d2hmqb_ (2hmq B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.4: Hemerythrin [47188] (1 family)

5. Family a.24.4.1: Hemerythrin [47189] (2 proteins)
   Iron-binding proteins

6. Protein Hemerythrin [47190] (2 species)

7. Species Sipunculid worm (Themiste dyscrita) [47191] (4 PDB entries)

8. Domain d2hmqb_: 2hmq B: [16569]

Details for d2hmqb_

PDB Entry: 2hmq, 1.66 Å

PDB Description: the structures of met and azidomet hemerythrin at 1.66 angstroms resolution

SCOP Domain Sequences for d2hmqb_:

Sequence; same for both SEQRES and ATOM records:

>d2hmqb_ a.24.4.1 (B:) Hemerythrin {Sipunculid worm (Themiste dyscrita)}
gfpipdpycwdisfrtfytivddehktlfngilllsqadnadhlnelrrctgkhflneqq
lmqasqyagyaehkkahddfihkldtwdgdvtyaknwlvnhiktidfkyrgki

Timeline for d2hmqb_:

• d2hmqb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hmqb_ appears in SCOP 1.61
  
• d2hmqb_ appears in SCOP 1.65
  
• d2hmqb_ appears in the current release, SCOPe 2.08