SCOPe 2.05: Domain d2ioma_: 2iom A:

Lineage for d2ioma_ (2iom A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein automated matches [190198] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187745] (7 PDB entries)

8. Domain d2ioma_: 2iom A: [165626]
   automated match to d1hu8a_
   complexed with ipa, trs, zn

Details for d2ioma_

PDB Entry: 2iom, 2 Å

PDB Description: mouse p53 core domain soaked with 2-propanol

PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d2ioma_:

Sequence; same for both SEQRES and ATOM records:

>d2ioma_ b.2.5.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qktyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvra
maiykksqhmtevvrrcphhercsdgdglappqhlirvegnlypeyledrqtfrhsvvvp
yeppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpg
rdrrtee

Timeline for d2ioma_:

• d2ioma_ first appeared in SCOPe 2.01
  
• d2ioma_ appears in SCOPe 2.04
  
• d2ioma_ appears in SCOPe 2.06
  
• d2ioma_ appears in the current release, SCOPe 2.08