![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein automated matches [190198] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187745] (7 PDB entries) |
![]() | Domain d2ioma_: 2iom A: [165626] automated match to d1hu8a_ complexed with ipa, trs, zn |
PDB Entry: 2iom (more details), 2 Å
SCOPe Domain Sequences for d2ioma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioma_ b.2.5.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qktyqgnygfhlgflqsgtaksvmctyspplnklfcqlaktcpvqlwvsatppagsrvra maiykksqhmtevvrrcphhercsdgdglappqhlirvegnlypeyledrqtfrhsvvvp yeppeagseyttihykymcnsscmggmnrrpiltiitledssgnllgrdsfevrvcacpg rdrrtee
Timeline for d2ioma_: