Lineage for d2ijjc_ (2ijj C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2322230Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2322231Superfamily a.30.1: ROP protein [47380] (1 family) (S)
    automatically mapped to Pfam PF01815
  5. 2322232Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 2322233Protein ROP protein [47382] (1 species)
  7. 2322234Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 2322248Domain d2ijjc_: 2ijj C: [165589]
    automated match to d1rpra_
    mutant

Details for d2ijjc_

PDB Entry: 2ijj (more details), 1.9 Å

PDB Description: crystal structure analysis of cole1 rom mutant f14y
PDB Compounds: (C:) Regulatory protein rop

SCOPe Domain Sequences for d2ijjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijjc_ a.30.1.1 (C:) ROP protein {Escherichia coli [TaxId: 562]}
gtkqektalnmaryirsqtltlleklneldadeqadiceslhdhadelyrsclarf

SCOPe Domain Coordinates for d2ijjc_:

Click to download the PDB-style file with coordinates for d2ijjc_.
(The format of our PDB-style files is described here.)

Timeline for d2ijjc_: