Lineage for d2if5a_ (2if5 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903244Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1903245Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1903467Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1903468Protein automated matches [190710] (3 species)
    not a true protein
  7. 1903469Species Human (Homo sapiens) [TaxId:9606] [187857] (25 PDB entries)
  8. 1903482Domain d2if5a_: 2if5 A: [165531]
    automated match to d1buoa_
    complexed with pr

Details for d2if5a_

PDB Entry: 2if5 (more details), 2 Å

PDB Description: Structure of the POZ domain of human LRF, a master regulator of oncogenesis
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 7A

SCOPe Domain Sequences for d2if5a_:

Sequence, based on SEQRES records: (download)

>d2if5a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsgav
vdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld

Sequence, based on observed residues (ATOM records): (download)

>d2if5a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
igipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsqqn
vyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlld

SCOPe Domain Coordinates for d2if5a_:

Click to download the PDB-style file with coordinates for d2if5a_.
(The format of our PDB-style files is described here.)

Timeline for d2if5a_: