Lineage for d2if0b_ (2if0 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125676Species Mouse (Mus musculus) [TaxId:10090] [186896] (17 PDB entries)
  8. 2125699Domain d2if0b_: 2if0 B: [165530]
    automated match to d2f7sa1
    complexed with gdp, mg

Details for d2if0b_

PDB Entry: 2if0 (more details), 2.8 Å

PDB Description: Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group
PDB Compounds: (B:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2if0b_:

Sequence, based on SEQRES records: (download)

>d2if0b_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasgka
fkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycen
pdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrm
ekcve

Sequence, based on observed residues (ATOM records): (download)

>d2if0b_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydafkvhlqlwdt
aglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignka
dlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcve

SCOPe Domain Coordinates for d2if0b_:

Click to download the PDB-style file with coordinates for d2if0b_.
(The format of our PDB-style files is described here.)

Timeline for d2if0b_: