Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
Superfamily d.86.1: eIF4e-like [55418] (3 families) |
Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
Protein automated matches [190708] (10 species) not a true protein |
Species Wheat (Triticum aestivum) [TaxId:4565] [187854] (2 PDB entries) |
Domain d2idra_: 2idr A: [165513] automated match to d2v8we1 |
PDB Entry: 2idr (more details), 1.85 Å
SCOPe Domain Sequences for d2idra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idra_ d.86.1.0 (A:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]} ahplenawtfwfdnpqgksrqvawgstihpihtfstvedfwglynnihnpsklnvgadfh cfknkiepkwedpicanggkwtiscgrgksdtfwlhtllamigeqfdfgdeicgavvsvr qkqervaiwtknaaneaaqisigkqwkefldykdsigfivhedakrsdkgpknrytv
Timeline for d2idra_: