Lineage for d2idrb_ (2idr B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962831Species Wheat (Triticum aestivum) [TaxId:4565] [187854] (2 PDB entries)
  8. 2962833Domain d2idrb_: 2idr B: [165514]
    automated match to d2v8we1

Details for d2idrb_

PDB Entry: 2idr (more details), 1.85 Å

PDB Description: crystal structure of translation initiation factor eif4e from wheat
PDB Compounds: (B:) Eukaryotic translation initiation factor 4E-1

SCOPe Domain Sequences for d2idrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idrb_ d.86.1.0 (B:) automated matches {Wheat (Triticum aestivum) [TaxId: 4565]}
ahplenawtfwfdnpqgksrqvawgstihpihtfstvedfwglynnihnpsklnvgadfh
cfknkiepkwedpicanggkwtiscgrgksdtfwlhtllamigeqfdfgdeicgavvsvr
qkqervaiwtknaaneaaqisigkqwkefldykdsigfivhedakrsdkgpknrytv

SCOPe Domain Coordinates for d2idrb_:

Click to download the PDB-style file with coordinates for d2idrb_.
(The format of our PDB-style files is described here.)

Timeline for d2idrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2idra_