SCOPe 2.04: Domain d2i3pb_: 2i3p B:

Lineage for d2i3pb_ (2i3p B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (3 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (6 proteins)
   contains two extra helices in the C-terminal extension

6. Protein automated matches [190411] (3 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [187286] (9 PDB entries)

8. Domain d2i3pb_: 2i3p B: [165378]
   automated match to d1bp7a_
   protein/DNA complex; complexed with ca; mutant

Details for d2i3pb_

PDB Entry: 2i3p, 2.3 Å

PDB Description: k28r mutant of homing endonuclease i-crei

PDB Compounds: (B:) DNA endonuclease I-crei

SCOPe Domain Sequences for d2i3pb_:

Sequence; same for both SEQRES and ATOM records:

>d2i3pb_ d.95.2.1 (B:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ntkynkefllylagfvdgdgsiiaqirpnqsykfkhqlsltfqvtqktqrrwfldklvde
igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
flevctwvdqiaalndsktrkttsetvravld

Timeline for d2i3pb_:

• d2i3pb_ first appeared in SCOPe 2.01
  
• d2i3pb_ appears in SCOPe 2.03
  
• d2i3pb_ appears in SCOPe 2.05
  
• d2i3pb_ appears in the current release, SCOPe 2.08