Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.2: Cofilin-like [55762] (8 proteins) |
Protein automated matches [190045] (5 species) not a true protein |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [187836] (1 PDB entry) |
Domain d2i2qa_: 2i2q A: [165374] automated match to d1cfya_ complexed with edo, lda, so4 |
PDB Entry: 2i2q (more details), 1.72 Å
SCOPe Domain Sequences for d2i2qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2qa_ d.109.1.2 (A:) automated matches {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} sfsgvkvspecleafqelklgkslryvvfkmndtkteivvekkstdkdfdtflgdlpekd cryaiydfefnlgegvrnkiifiswspdvapikskmvyssskdtlrraftgigtdiqatd fs
Timeline for d2i2qa_: