Class g: Small proteins [56992] (90 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.0: automated matches [191380] (1 protein) not a true family |
Protein automated matches [190474] (1 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries) |
Domain d2i0th_: 2i0t H: [165363] automated match to d1mg2b_ complexed with pel |
PDB Entry: 2i0t (more details), 1.35 Å
SCOPe Domain Sequences for d2i0th_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i0th_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]} hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg la
Timeline for d2i0th_: