Lineage for d2i0rd_ (2i0r D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034551Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 3034552Protein automated matches [190474] (1 species)
    not a true protein
  7. 3034553Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 3034562Domain d2i0rd_: 2i0r D: [165358]
    automated match to d1mg2b_

Details for d2i0rd_

PDB Entry: 2i0r (more details), 1.4 Å

PDB Description: Crystal structure of aromatic amine dehydrogenase TTQ-formamide adduct
PDB Compounds: (D:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2i0rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0rd_ g.21.1.0 (D:) automated matches {Alcaligenes faecalis [TaxId: 511]}
hislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphd
gkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvg
lakn

SCOPe Domain Coordinates for d2i0rd_:

Click to download the PDB-style file with coordinates for d2i0rd_.
(The format of our PDB-style files is described here.)

Timeline for d2i0rd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2i0rh_