Lineage for d2hxch_ (2hxc H:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064542Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1064543Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1064601Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 1064602Protein automated matches [190474] (1 species)
    not a true protein
  7. 1064603Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 1064623Domain d2hxch_: 2hxc H: [165329]
    automated match to d1mg2b_
    complexed with abn

Details for d2hxch_

PDB Entry: 2hxc (more details), 1.45 Å

PDB Description: Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in N-semiquinone form
PDB Compounds: (H:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2hxch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxch_ g.21.1.0 (H:) automated matches {Alcaligenes faecalis [TaxId: 511]}
evnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphdgkdylisyhdcc
gktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvgla

SCOPe Domain Coordinates for d2hxch_:

Click to download the PDB-style file with coordinates for d2hxch_.
(The format of our PDB-style files is described here.)

Timeline for d2hxch_: