SCOPe 2.02: Domain d2hxab_: 2hxa B:

Lineage for d2hxab_ (2hxa B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (74 PDB entries)
   Uniprot P00282

8. Domain d2hxab_: 2hxa B: [165327]
   automated match to d1azna_
   complexed with cu1

Details for d2hxab_

PDB Entry: 2hxa, 2.21 Å

PDB Description: crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph3.5

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d2hxab_:

Sequence; same for both SEQRES and ATOM records:

>d2hxab_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagm
kgtltlk

Timeline for d2hxab_:

• d2hxab_ first appeared in SCOPe 2.01
  
• d2hxab_ appears in SCOPe 2.03
  
• d2hxab_ appears in the current release, SCOPe 2.08