SCOPe 2.08: Domain d2hx8b_: 2hx8 B:

Lineage for d2hx8b_ (2hx8 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (96 PDB entries)
   Uniprot P00282

8. Domain d2hx8b_: 2hx8 B: [165323]
   automated match to d1azna_
   complexed with cu1

Details for d2hx8b_

PDB Entry: 2hx8, 1.6 Å

PDB Description: crystal structure of cu(i) azurin with the metal-binding loop sequence "ctfpghsalm" replaced with "csphqgagm", at ph5

PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d2hx8b_:

Sequence; same for both SEQRES and ATOM records:

>d2hx8b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagm
kgtltlk

Timeline for d2hx8b_:

• d2hx8b_ first appeared in SCOPe 2.01
  
• d2hx8b_ appears in SCOPe 2.07