PDB entry 2hx8

View 2hx8 on RCSB PDB site
Description: Crystal structure of Cu(I) Azurin with the metal-binding loop sequence "CTFPGHSALM" replaced with "CSPHQGAGM", at pH5
Class: electron transport
Keywords: blue copper-binding protein, greek-key beta-barrel, loop mutagenesis, electron transport
Deposited on 2006-08-03, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.14
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (Start-126)
      • see remark 999 (112)
      • see remark 999 (114-116)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2hx8a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-126)
      • see remark 999 (112)
      • see remark 999 (114-116)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2hx8b_
  • Heterogens: CU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hx8A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagm
    kgtltlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hx8A (A:)
    csvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvvtd
    gmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagmkg
    tltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hx8B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffcsphqgagm
    kgtltlk