Lineage for d2hwua_ (2hwu A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496076Protein Uridine phosphorylase [53176] (6 species)
  7. 2496190Species Salmonella typhimurium [TaxId:90371] [117656] (24 PDB entries)
    Uniprot P0A1F6
  8. 2496276Domain d2hwua_: 2hwu A: [165310]
    automated match to d1ryza_
    complexed with po4, uri

Details for d2hwua_

PDB Entry: 2hwu (more details), 2.91 Å

PDB Description: Crystal structure of the uridine phosphorylase from Salmonella typhimurium in complex with uridine and phosphate ion at 2.91A resolution
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d2hwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hwua_ c.56.2.1 (A:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
msksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgk
avivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgas
lhfapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrf
kgsmeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqtesh
avkivveaarrll

SCOPe Domain Coordinates for d2hwua_:

Click to download the PDB-style file with coordinates for d2hwua_.
(The format of our PDB-style files is described here.)

Timeline for d2hwua_: