Lineage for d2ligb_ (2lig B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 909879Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (1 family) (S)
  5. 909880Family a.24.2.1: Aspartate receptor, ligand-binding domain [47171] (1 protein)
  6. 909881Protein Aspartate receptor, ligand-binding domain [47172] (2 species)
  7. 909884Species Salmonella typhimurium [TaxId:90371] [47174] (7 PDB entries)
  8. 909886Domain d2ligb_: 2lig B: [16531]
    complexed with asp, phn, so4

Details for d2ligb_

PDB Entry: 2lig (more details), 2 Å

PDB Description: three-dimensional structures of the ligand-binding domain of the bacterial aspartate receptor with and without a ligand
PDB Compounds: (B:) aspartate receptor

SCOPe Domain Sequences for d2ligb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ligb_ a.24.2.1 (B:) Aspartate receptor, ligand-binding domain {Salmonella typhimurium [TaxId: 90371]}
mggllfsslqhcqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqss
aktdllqnakttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldng
nmdayfaqptqgmqnalgealgnyarvsenlyrqtfd

SCOPe Domain Coordinates for d2ligb_:

Click to download the PDB-style file with coordinates for d2ligb_.
(The format of our PDB-style files is described here.)

Timeline for d2ligb_: