Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) |
Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins automatically mapped to Pfam PF01880 |
Protein automated matches [190694] (3 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [187828] (1 PDB entry) |
Domain d2hvbd_: 2hvb D: [165305] automated match to d1do6a_ complexed with fe |
PDB Entry: 2hvb (more details), 2.5 Å
SCOPe Domain Sequences for d2hvbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvbd_ b.1.13.1 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} mlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle
Timeline for d2hvbd_: