Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) |
Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins) binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins |
Protein automated matches [190694] (1 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [187828] (1 PDB entry) |
Domain d2hvbb_: 2hvb B: [165303] automated match to d1do6a_ complexed with fe |
PDB Entry: 2hvb (more details), 2.5 Å
SCOPe Domain Sequences for d2hvbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvbb_ b.1.13.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle
Timeline for d2hvbb_: