SCOPe 2.01: Domain d2hvbb_: 2hvb B:

Lineage for d2hvbb_ (2hvb B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins

6. Protein automated matches [190694] (1 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187828] (1 PDB entry)

8. Domain d2hvbb_: 2hvb B: [165303]
   automated match to d1do6a_
   complexed with fe

Details for d2hvbb_

PDB Entry: 2hvb, 2.5 Å

PDB Description: Crystal structure of hypothetical protein PH1083 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) superoxide reductase

SCOPe Domain Sequences for d2hvbb_:

Sequence; same for both SEQRES and ATOM records:

>d2hvbb_ b.1.13.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mlketirsgdwkgekhvpvieyeregdlvkvevsvgkeiphpntpehhiawielyfhpeg
gqfpilvgrveftnhsdpltepravfffktskkgklyalsycnihglwenevqle

Timeline for d2hvbb_:

• d2hvbb_ is new in SCOPe 2.01-stable
  
• d2hvbb_ appears in SCOPe 2.02
  
• d2hvbb_ appears in the current release, SCOPe 2.08