Lineage for d2hs1a_ (2hs1 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2067628Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2067644Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2067878Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2067879Domain d2hs1a_: 2hs1 A: [165226]
    automated match to d1fgcc_
    complexed with 017, cl, dms; mutant

Details for d2hs1a_

PDB Entry: 2hs1 (more details), 0.84 Å

PDB Description: ultra-high resolution x-ray crystal structure of hiv-1 protease v32i mutant with tmc114 (darunavir) inhibitor
PDB Compounds: (A:) hiv-1 protease

SCOPe Domain Sequences for d2hs1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hs1a_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtiieemslpgrwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf

SCOPe Domain Coordinates for d2hs1a_:

Click to download the PDB-style file with coordinates for d2hs1a_.
(The format of our PDB-style files is described here.)

Timeline for d2hs1a_: