Lineage for d1fz5f_ (1fz5 F:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151161Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
  4. 151181Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 151182Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 151183Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 151184Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries)
  8. 151208Domain d1fz5f_: 1fz5 F: [16517]
    Other proteins in same PDB: d1fz5a_, d1fz5b_, d1fz5c_, d1fz5d_

Details for d1fz5f_

PDB Entry: 1fz5 (more details), 2.4 Å

PDB Description: methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme

SCOP Domain Sequences for d1fz5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fz5f_ a.23.3.1 (F:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsph

SCOP Domain Coordinates for d1fz5f_:

Click to download the PDB-style file with coordinates for d1fz5f_.
(The format of our PDB-style files is described here.)

Timeline for d1fz5f_: