Lineage for d2hnvc_ (2hnv C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383117Fold b.9: Neurophysin II [49605] (1 superfamily)
    sandwich; 8 strands in 2 sheets; meander
  4. 2383118Superfamily b.9.1: Neurophysin II [49606] (1 family) (S)
    duplication: composed of two structural repeats
    automatically mapped to Pfam PF00184
  5. 2383119Family b.9.1.1: Neurophysin II [49607] (1 protein)
  6. 2383120Protein Neurophysin II [49608] (1 species)
    can be classified as disulfide-rich
  7. 2383121Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries)
  8. 2383138Domain d2hnvc_: 2hnv C: [165169]
    automated match to d1l5ca_
    complexed with phe, tyr; mutant

Details for d2hnvc_

PDB Entry: 2hnv (more details), 2.5 Å

PDB Description: crystal structure of a dipeptide complex of the q58v mutant of bovine neurophysin-i
PDB Compounds: (C:) Oxytocin-neurophysin 1

SCOPe Domain Sequences for d2hnvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hnvc_ b.9.1.1 (C:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]}
vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgvkpcgsggr
caaagiccspdgchedpacdp

SCOPe Domain Coordinates for d2hnvc_:

Click to download the PDB-style file with coordinates for d2hnvc_.
(The format of our PDB-style files is described here.)

Timeline for d2hnvc_: