Class b: All beta proteins [48724] (178 folds) |
Fold b.9: Neurophysin II [49605] (1 superfamily) sandwich; 8 strands in 2 sheets; meander |
Superfamily b.9.1: Neurophysin II [49606] (1 family) duplication: composed of two structural repeats automatically mapped to Pfam PF00184 |
Family b.9.1.1: Neurophysin II [49607] (1 protein) |
Protein Neurophysin II [49608] (1 species) can be classified as disulfide-rich |
Species Cow (Bos taurus) [TaxId:9913] [49609] (11 PDB entries) |
Domain d2hnvc_: 2hnv C: [165169] automated match to d1l5ca_ complexed with phe, tyr; mutant |
PDB Entry: 2hnv (more details), 2.5 Å
SCOPe Domain Sequences for d2hnvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hnvc_ b.9.1.1 (C:) Neurophysin II {Cow (Bos taurus) [TaxId: 9913]} vrtclpcgpggkgrcfgpsiccgdelgcfvgtaealrcqeenylpspcqsgvkpcgsggr caaagiccspdgchedpacdp
Timeline for d2hnvc_:
View in 3D Domains from other chains: (mouse over for more information) d2hnva_, d2hnvb_, d2hnvd_, d2hnve_ |