SCOPe 2.08: Domain d2hkmd_: 2hkm D:

Lineage for d2hkmd_ (2hkm D:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.0: automated matches [191380] (1 protein)
   not a true family

6. Protein automated matches [190474] (1 species)
   not a true protein

7. Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)

8. Domain d2hkmd_: 2hkm D: [165132]
   automated match to d1mg2b_
   complexed with pea

Details for d2hkmd_

PDB Entry: 2hkm, 1.5 Å

PDB Description: Crystal structure of the Schiff base intermediate in the reductive half-reaction of aromatic amine dehydrogenase (AADH) with phenylethylamine.

PDB Compounds: (D:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2hkmd_:

Sequence; same for both SEQRES and ATOM records:

>d2hkmd_ g.21.1.0 (D:) automated matches {Alcaligenes faecalis [TaxId: 511]}
evnscdywrhcavdgflcsccggttttcppgstpspiswigtchnphdgkdylisyhdcc
gktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsvlvgla

Timeline for d2hkmd_:

• d2hkmd_ first appeared in SCOPe 2.01
  
• d2hkmd_ appears in SCOPe 2.07