Lineage for d2hfne_ (2hfn E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196354Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 2196422Family d.58.10.0: automated matches [191394] (1 protein)
    not a true family
  6. 2196423Protein automated matches [190511] (7 species)
    not a true protein
  7. 2196469Species Synechocystis sp. [TaxId:1143] [187802] (1 PDB entry)
  8. 2196474Domain d2hfne_: 2hfn E: [165084]
    automated match to d1x0pb1
    complexed with fmn

Details for d2hfne_

PDB Entry: 2hfn (more details), 1.8 Å

PDB Description: Crystal Structures of the Synechocystis Photoreceptor Slr1694 Reveal Distinct Structural States Related to Signaling
PDB Compounds: (E:) Synechocystis Photoreceptor (Slr1694)

SCOPe Domain Sequences for d2hfne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hfne_ d.58.10.0 (E:) automated matches {Synechocystis sp. [TaxId: 1143]}
slyrliyssqgipnlqpqdlkdilessqrnnpangitgllcyskpaflqvlegeceqvne
tyhrivqderhhspqiiecmpirrrnfevwsmqaitvndlsteqvktlvlkysgfttlrp
samdpeqclnflldiakiy

SCOPe Domain Coordinates for d2hfne_:

Click to download the PDB-style file with coordinates for d2hfne_.
(The format of our PDB-style files is described here.)

Timeline for d2hfne_: