| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) ![]() duplication: consists of two domains of this fold automatically mapped to Pfam PF02964 |
| Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins) |
| Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) |
| Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries) |
| Domain d1fyze_: 1fyz E: [16508] Other proteins in same PDB: d1fyza_, d1fyzb_, d1fyzc_, d1fyzd_ complexed with ca, fe2 |
PDB Entry: 1fyz (more details), 2.15 Å
SCOPe Domain Sequences for d1fyze_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fyze_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqsp
Timeline for d1fyze_: