SCOPe 2.01: Domain d2haqa_: 2haq A:

Lineage for d2haqa_ (2haq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)

6. Protein automated matches [190077] (10 species)
   not a true protein

7. Species Leishmania donovani [TaxId:5661] [187796] (2 PDB entries)

8. Domain d2haqa_: 2haq A: [165037]
   automated match to d1xo7a_

Details for d2haqa_

PDB Entry: 2haq, 1.97 Å

PDB Description: crystal structure of cyclophilin a from leishmania donovani

PDB Compounds: (A:) cyclophilin

SCOPe Domain Sequences for d2haqa_:

Sequence; same for both SEQRES and ATOM records:

>d2haqa_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
epevtakvyfdvmidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrviq
nfmiqggdftnfdgtggksiygekfadenlnvkhfvgalsmanagpntngsqffittapt
pwldgrhvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel

Timeline for d2haqa_:

• d2haqa_ is new in SCOPe 2.01-stable
  
• d2haqa_ appears in SCOPe 2.02
  
• d2haqa_ appears in the current release, SCOPe 2.08