| Class b: All beta proteins [48724] (174 folds) |
| Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) |
| Protein automated matches [190077] (10 species) not a true protein |
| Species Leishmania donovani [TaxId:5661] [187796] (2 PDB entries) |
| Domain d2haqa_: 2haq A: [165037] automated match to d1xo7a_ |
PDB Entry: 2haq (more details), 1.97 Å
SCOPe Domain Sequences for d2haqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2haqa_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
epevtakvyfdvmidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrviq
nfmiqggdftnfdgtggksiygekfadenlnvkhfvgalsmanagpntngsqffittapt
pwldgrhvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel
Timeline for d2haqa_: