Lineage for d2h8va_ (2h8v A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711884Protein Pheromone-binding protein asp1 [101192] (1 species)
  7. 2711885Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (15 PDB entries)
  8. 2711904Domain d2h8va_: 2h8v A: [165014]
    automated match to d1r5ra_
    complexed with cl, gol, so4

Details for d2h8va_

PDB Entry: 2h8v (more details), 2.6 Å

PDB Description: structure of empty pheromone binding protein asp1 from the honeybee apis mellifera l
PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d2h8va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h8va_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]}
dwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdde
anvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

SCOPe Domain Coordinates for d2h8va_:

Click to download the PDB-style file with coordinates for d2h8va_.
(The format of our PDB-style files is described here.)

Timeline for d2h8va_: