Lineage for d1egmm_ (1egm M:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312626Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
    core: 3 helices; bundle, open
  4. 2312634Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
    automatically mapped to Pfam PF02287
  5. 2312635Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins)
  6. 2312636Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 2312637Species Klebsiella oxytoca [TaxId:571] [47151] (8 PDB entries)
  8. 2312647Domain d1egmm_: 1egm M: [16495]
    Other proteins in same PDB: d1egma_, d1egmb_, d1egme_, d1egml_
    complexed with cnc, k, pgo

Details for d1egmm_

PDB Entry: 1egm (more details), 1.85 Å

PDB Description: crystal structure of diol dehydratase-cyanocobalamin complex at 100k.
PDB Compounds: (M:) propanediol dehydratase

SCOPe Domain Sequences for d1egmm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egmm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella oxytoca [TaxId: 571]}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOPe Domain Coordinates for d1egmm_:

Click to download the PDB-style file with coordinates for d1egmm_.
(The format of our PDB-style files is described here.)

Timeline for d1egmm_: