SCOPe 2.01: Domain d2h29b_: 2h29 B:

Lineage for d2h29b_ (2h29 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)

7. Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries)

8. Domain d2h29b_: 2h29 B: [164921]
   automated match to d1kama_
   complexed with dnd

Details for d2h29b_

PDB Entry: 2h29, 2 Å

PDB Description: Crystal structure of Nicotinic acid mononucleotide Adenylyltransferase from Staphylococcus aureus: product bound form 1

PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d2h29b_:

Sequence; same for both SEQRES and ATOM records:

>d2h29b_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]}
mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi
qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie
ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny
ikgeglye

Timeline for d2h29b_:

• d2h29b_ is new in SCOPe 2.01-stable
  
• d2h29b_ appears in SCOPe 2.02
  
• d2h29b_ appears in the current release, SCOPe 2.08