Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species) |
Species Staphylococcus aureus [TaxId:1280] [187783] (2 PDB entries) |
Domain d2h29b_: 2h29 B: [164921] automated match to d1kama_ complexed with dnd |
PDB Entry: 2h29 (more details), 2 Å
SCOPe Domain Sequences for d2h29b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h29b_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Staphylococcus aureus [TaxId: 1280]} mkkivlyggqfnpihtahmivasevfhelqpdefyflpsfmsplkkhhdfidvqhrltmi qmiidelgfgdicddeikrggqsytydtikafkeqhkdselyfvigtdqynqlekwyqie ylkemvtfvvvnrdknsqnvenamiaiqiprvdisstmirqrvsegksiqvlvpksveny ikgeglye
Timeline for d2h29b_: