Class a: All alpha proteins [46456] (289 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein automated matches [190675] (10 species) not a true protein |
Species Acetobacter aceti [TaxId:435] [187782] (1 PDB entry) |
Domain d2h12c_: 2h12 C: [164898] automated match to d1k3pa_ complexed with cmx, oaa, so4 |
PDB Entry: 2h12 (more details), 1.85 Å
SCOPe Domain Sequences for d2h12c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h12c_ a.103.1.1 (C:) automated matches {Acetobacter aceti [TaxId: 435]} statisvdgksaempvlsgtlgpdvidirklpaqlgvftfdpgygetaacnskitfidgd kgvllhrgypiaqlaenasyeeviylllngelpnkaqydtftntltnhtllheqirnffn gfrrdahpmailcgtvgalsafypdandiaipanrdlaamrliakiptiaawaykytqge afiyprndlnyaenflsmmfarmsepykvnpvlaramnrililhadheqnaststvrlag stganpfaciaagiaalwgpahgganeavlkmlarigkkenipafiaqvkdknsgvklmg fghrvyknfdprakimqqtchevltelgikddplldlavelekialsddyfvqrklypnv dfysgiilkamgiptsmftvlfavarttgwvsqwkemieepgqrisrprqlyigapqrdy vplakr
Timeline for d2h12c_: