Class a: All alpha proteins [46456] (226 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.3: TBP-associated factors, TAFs [47134] (11 proteins) |
Protein TAF(II)28 [47141] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47142] (2 PDB entries) |
Domain d1bh9b_: 1bh9 B: [16485] Other proteins in same PDB: d1bh9a_ complexed with pmb |
PDB Entry: 1bh9 (more details), 2.6 Å
SCOP Domain Sequences for d1bh9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens)} fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv cekwgempplqpkhmreavrrlkskgqip
Timeline for d1bh9b_: