Lineage for d2gv0a_ (2gv0 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1397247Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1397248Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1397278Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1398138Protein automated matches [190299] (5 species)
    not a true protein
  7. 1398166Species Pelodiscus sinensis [TaxId:13735] [187773] (1 PDB entry)
  8. 1398167Domain d2gv0a_: 2gv0 A: [164849]
    automated match to d1ivma_
    complexed with so4

Details for d2gv0a_

PDB Entry: 2gv0 (more details), 1.9 Å

PDB Description: The structure of the orthorhombic form of soft-shelled turtle lysozyme at 1.9 angstroms resolution
PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d2gv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gv0a_ d.2.1.2 (A:) automated matches {Pelodiscus sinensis [TaxId: 13735]}
gkiyeqcelarefkrhgmdgyhgyslgdwvctakhesnfntaatnynrgdqstdygilqi
nsrwwcndgktpkaknacgiecsellkaditaavncakrivrdpngmgawvawtkyckgk
dvsqwikgckl

SCOPe Domain Coordinates for d2gv0a_:

Click to download the PDB-style file with coordinates for d2gv0a_.
(The format of our PDB-style files is described here.)

Timeline for d2gv0a_: