PDB entry 2gv0

View 2gv0 on RCSB PDB site
Description: The structure of the orthorhombic form of soft-shelled turtle lysozyme at 1.9 angstroms resolution
Class: Hydrolase
Keywords: lysozyme, hydrolase
Deposited on 2006-05-02, released 2007-05-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.207
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysozyme C
  Species: Pelodiscus sinensis [TaxId:13735]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7LZQ1 (0-130)
  Domains in SCOPe 2.03: d2gv0a_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2gv0A (A:)
  gkiyeqcelarefkrhgmdgyhgyslgdwvctakhesnfntaatnynrgdqstdygilqi
  nsrwwcndgktpkaknacgiecsellkaditaavncakrivrdpngmgawvawtkyckgk
  dvsqwikgckl