Lineage for d1bh9a_ (1bh9 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279048Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 279049Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 279178Family a.22.1.3: TBP-associated factors, TAFs [47134] (10 proteins)
  6. 279199Protein TAF(II)18 [47139] (1 species)
  7. 279200Species Human (Homo sapiens) [TaxId:9606] [47140] (2 PDB entries)
  8. 279201Domain d1bh9a_: 1bh9 A: [16483]
    Other proteins in same PDB: d1bh9b_
    complexed with pmb

Details for d1bh9a_

PDB Entry: 1bh9 (more details), 2.6 Å

PDB Description: htafii18/htafii28 heterodimer crystal structure with bound pcmbs

SCOP Domain Sequences for d1bh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bh9a_ a.22.1.3 (A:) TAF(II)18 {Human (Homo sapiens)}
lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi

SCOP Domain Coordinates for d1bh9a_:

Click to download the PDB-style file with coordinates for d1bh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1bh9a_: