![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein TAF(II)18 [47139] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47140] (2 PDB entries) |
![]() | Domain d1bh9a_: 1bh9 A: [16483] Other proteins in same PDB: d1bh9b_ complexed with pmb fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1bh9 (more details), 2.6 Å
SCOPe Domain Sequences for d1bh9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh9a_ a.22.1.3 (A:) TAF(II)18 {Human (Homo sapiens) [TaxId: 9606]} lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi
Timeline for d1bh9a_: