SCOPe 2.01: Domain d2gonb_: 2gon B:

Lineage for d2gonb_ (2gon B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (17 PDB entries)

8. Domain d2gonb_: 2gon B: [164785]
   automated match to d1afva_
   complexed with flc

Details for d2gonb_

PDB Entry: 2gon, 1.9 Å

PDB Description: xray structure of gag133-278

PDB Compounds: (B:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2gonb_:

Sequence; same for both SEQRES and ATOM records:

>d2gonb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
mvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqml
ketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmthnppipvgei
ykrwiilglnkivrmys

Timeline for d2gonb_:

• d2gonb_ is new in SCOPe 2.01-stable
  
• d2gonb_ appears in SCOPe 2.02
  
• d2gonb_ appears in the current release, SCOPe 2.08