SCOPe 2.08: Domain d2gfea1: 2gfe A:3-261

Lineage for d2gfea1 (2gfe A:3-261)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)

8. Domain d2gfea1: 2gfe A:3-261 [164677]
   Other proteins in same PDB: d2gfea2, d2gfeb2, d2gfec2
   automated match to d1mm6a_
   complexed with glu, zn; mutant

Details for d2gfea1

PDB Entry: 2gfe, 1.54 Å

PDB Description: crystal structure of the glur2 a476e s673d ligand binding core mutant at 1.54 angstroms resolution

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2gfea1:

Sequence; same for both SEQRES and ATOM records:

>d2gfea1 c.94.1.1 (A:3-261) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardedtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtlddgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

Timeline for d2gfea1:

• d2gfea1 first appeared in SCOPe 2.01, called d2gfea_
  
• d2gfea1 appears in SCOPe 2.07