Lineage for d2gbxd_ (2gbx D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1896198Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1896937Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1896938Protein automated matches [190205] (21 species)
    not a true protein
  7. 1896991Species Sphingobium yanoikuyae [TaxId:13690] [187741] (2 PDB entries)
  8. 1896996Domain d2gbxd_: 2gbx D: [164662]
    Other proteins in same PDB: d2gbxa1, d2gbxa2, d2gbxc1, d2gbxc2, d2gbxe1, d2gbxe2
    automated match to d1ulid_
    complexed with bnl, fe, fes, zn

Details for d2gbxd_

PDB Entry: 2gbx (more details), 2.8 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl
PDB Compounds: (D:) Biphenyl 2,3-Dioxygenase Beta Subunit

SCOPe Domain Sequences for d2gbxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbxd_ d.17.4.0 (D:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
qipvtpdvhydieahyraevrmfqtgqyrewlqgmvaedihywmpiyeqrltrdrrpdpt
pddaaiynddfgelkqrverlysgqvwmedppskiryfvsnveafeagngeldvlsnilv
yrnrrqtevtvhtlgredklrrdgngfkvfrrklildarvtqdknlyffc

SCOPe Domain Coordinates for d2gbxd_:

Click to download the PDB-style file with coordinates for d2gbxd_.
(The format of our PDB-style files is described here.)

Timeline for d2gbxd_: