Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
Protein automated matches [190205] (26 species) not a true protein |
Species Sphingobium yanoikuyae [TaxId:13690] [187741] (2 PDB entries) |
Domain d2gbxd_: 2gbx D: [164662] Other proteins in same PDB: d2gbxa1, d2gbxa2, d2gbxc1, d2gbxc2, d2gbxe1, d2gbxe2 automated match to d1ulid_ complexed with bnl, fe, fes, zn |
PDB Entry: 2gbx (more details), 2.8 Å
SCOPe Domain Sequences for d2gbxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbxd_ d.17.4.0 (D:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]} qipvtpdvhydieahyraevrmfqtgqyrewlqgmvaedihywmpiyeqrltrdrrpdpt pddaaiynddfgelkqrverlysgqvwmedppskiryfvsnveafeagngeldvlsnilv yrnrrqtevtvhtlgredklrrdgngfkvfrrklildarvtqdknlyffc
Timeline for d2gbxd_: