Lineage for d2gbwb_ (2gbw B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1019632Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1020039Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1020659Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 1020660Protein automated matches [190205] (10 species)
    not a true protein
  7. 1020691Species Sphingobium yanoikuyae [TaxId:13690] [187741] (2 PDB entries)
  8. 1020692Domain d2gbwb_: 2gbw B: [164658]
    automated match to d1ulid_
    complexed with fe, fes, oxy

Details for d2gbwb_

PDB Entry: 2gbw (more details), 1.7 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1
PDB Compounds: (B:) Biphenyl 2,3-Dioxygenase Beta Subunit

SCOPe Domain Sequences for d2gbwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbwb_ d.17.4.0 (B:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
qipvtpdvhydieahyraevrmfqtgqyrewlqgmvaedihywmpiyeqrltrdrrpdpt
pddaaiynddfgelkqrverlysgqvwmedppskiryfvsnveafeagngeldvlsnilv
yrnrrqtevtvhtlgredklrrdgngfkvfrrklildarvtqdknlyffc

SCOPe Domain Coordinates for d2gbwb_:

Click to download the PDB-style file with coordinates for d2gbwb_.
(The format of our PDB-style files is described here.)

Timeline for d2gbwb_: