Lineage for d2gbtb_ (2gbt B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2360693Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2360694Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2360707Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2360810Species Human (Homo sapiens) [TaxId:9606] [49333] (81 PDB entries)
  8. 2360862Domain d2gbtb_: 2gbt B: [164641]
    automated match to d1l3na_
    complexed with cu1, zn

Details for d2gbtb_

PDB Entry: 2gbt (more details), 1.7 Å

PDB Description: c6a/c111a cuzn superoxide dismutase
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d2gbtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbtb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
tkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
phfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhaiigrtlvvhe
kaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d2gbtb_:

Click to download the PDB-style file with coordinates for d2gbtb_.
(The format of our PDB-style files is described here.)

Timeline for d2gbtb_: