Lineage for d1l3na_ (1l3n A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) 
has additional strand at N-terminusFamily b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) 
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries) 
Domain d1l3na_: 1l3n A: [73549]
complexed with cu1, zn
Details for d1l3na_
PDB Entry: 1l3n (more details)
PDB Description: the solution structure of reduced dimeric copper zinc sod: the structural effects of dimerization
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]SCOPe Domain Sequences for d1l3na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l3na_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq
SCOPe Domain Coordinates for d1l3na_:
Click to download the PDB-style file with coordinates for d1l3na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1l3na_:
- d1l3na_ first appeared in SCOP 1.61
- d1l3na_ appears in SCOPe 2.07
View in 3D
