SCOPe 2.08: Domain d2g99b_: 2g99 B:

Lineage for d2g99b_ (2g99 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.4: WD40 repeat-like [50978] (4 families)
   also contains 8-bladed propellers

5. Family b.69.4.0: automated matches [191412] (1 protein)
   not a true family

6. Protein automated matches [190568] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187559] (94 PDB entries)

8. Domain d2g99b_: 2g99 B: [164608]
   automated match to d1vyhc1
   protein/DNA complex

Details for d2g99b_

PDB Entry: 2g99, 1.9 Å

PDB Description: Structural basis for the specific recognition of methylated histone H3 lysine 4 by the WD-40 protein WDR5

PDB Compounds: (B:) wd-repeat protein 5

SCOPe Domain Sequences for d2g99b_:

Sequence; same for both SEQRES and ATOM records:

>d2g99b_ b.69.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvkpnyalkftlaghtkavssvkfspngewlasssadklikiwgaydgkfektisghklg
isdvawssdsnllvsasddktlkiwdvssgkclktlkghsnyvfccnfnpqsnlivsgsf
desvriwdvktgkclktlpahsdpvsavhfnrdgslivsssydglcriwdtasgqclktl
idddnppvsfvkfspngkyilaatldntlklwdyskgkclktytghknekycifanfsvt
ggkwivsgsednlvyiwnlqtkeivqklqghtdvvistachpteniiasaalendktikl
wksd

Timeline for d2g99b_:

• d2g99b_ first appeared in SCOPe 2.01
  
• d2g99b_ appears in SCOPe 2.07