Class g: Small proteins [56992] (92 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.2: PHD domain [57911] (14 proteins) |
Protein automated matches [190654] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries) |
Domain d2g6qa_: 2g6q A: [164589] automated match to d1wesa_ complexed with zn |
PDB Entry: 2g6q (more details), 2 Å
SCOPe Domain Sequences for d2g6qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g6qa_ g.50.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgdn
Timeline for d2g6qa_: