Lineage for d2g6qa_ (2g6q A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1067163Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1067164Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1067187Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1067235Protein automated matches [190654] (2 species)
    not a true protein
  7. 1067239Species Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries)
  8. 1067250Domain d2g6qa_: 2g6q A: [164589]
    automated match to d1wesa_
    complexed with zn

Details for d2g6qa_

PDB Entry: 2g6q (more details), 2 Å

PDB Description: Crystal structure of ING2 PHD finger in complex with H3K4Me3 peptide
PDB Compounds: (A:) Inhibitor of growth protein 2

SCOPe Domain Sequences for d2g6qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g6qa_ g.50.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eptyclcnqvsygemigcdneqcpiewfhfscvsltykpkgkwycpkcrgdn

SCOPe Domain Coordinates for d2g6qa_:

Click to download the PDB-style file with coordinates for d2g6qa_.
(The format of our PDB-style files is described here.)

Timeline for d2g6qa_: