Lineage for d2fzja_ (2fzj A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618271Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1618272Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1618273Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1618457Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1618577Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)
  8. 1618582Domain d2fzja_: 2fzj A: [164523]
    automated match to d1drfa_
    complexed with dh3, ndp

Details for d2fzja_

PDB Entry: 2fzj (more details), 2 Å

PDB Description: New Insights into DHFR Interactions: Analysis of Pneumocystis carinii and Mouse DHFR Complexes with NADPH and Two Highly Potent Trimethoprim Derivatives
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2fzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzja_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

SCOPe Domain Coordinates for d2fzja_:

Click to download the PDB-style file with coordinates for d2fzja_.
(The format of our PDB-style files is described here.)

Timeline for d2fzja_: